missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GORAB Control Fragment Recombinant Protein

Product Code. 30195987
missing translation for 'orderingAttributeHoverText'
Quantity:
100 μL
missing translation for 'unitSize'
100µL
This item is not returnable. View return policy

Product Code. 30195987

missing translation for 'mfr': Invitrogen™ RP94149

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (66%), Rat (66%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55543 (PA5-55543. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TCEB1 is known as protein elongin C, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Western blots using two different antibodies (P100962-T200 and P100963_P050 / P100963_P100) against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q5T7V8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 92344
Name Human GORAB Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI467484; dynactin 1, isoform 1; dynactin 1 (p150, Glued homolog); p150, Glued homolog; 150 kDa dynein-associated polypeptide; p150-glued; GO; golgin, RAB6 interacting; golgin, RAB6-interacting; Gorab; hNTKL-BP1; mNTKL-BP1; N-terminal kinase-like-binding protein 1; NTKL-binding protein 1; NTKLBP1; NTKL-BP1; RAB6-interacting golgin; RAB6-interacting golgin-like protein; SCY1-like 1 binding protein 1; SCY1-like 1-binding protein 1; SCYL1-binding protein 1; Scyl1bp1; SCYL1-BP1
Common Name GORAB
Gene Symbol Gorab
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MSWAAVLAVAAARFGHFWGCRWPGPMAQGWAGFSEEELRRLKQTKDPFEPQRRLPAKKSRQQLQREKALVEQSQKLGLQDGSTSLLPEQLLSAP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.