Invitrogen™ Human GON4L (aa 231-334) Control Fragment Recombinant Protein

Product Code. 30207502

Brand: Invitrogen™ RP106768

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66076 (PA5-66076. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Has transcriptional repressor activity, probably as part of a complex with YY1, SIN3A AND HDAC1. Required for B cell lymphopoiesis.

Specifications

• Accession Number: Q3T8J9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54856
• Name: Human GON4L (aa 231-334) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610100B20Rik; Dingo; Gon4; GON-4; GON-4 homolog; gon-4 like; GON4L; gon-4-like (C. elegans); GON-4-like protein; KIAA1606; Protein GON4; YARP; YY1AP related protein; YY1AP-related protein1
• Common Name: GON4L
• Gene Symbol: GON4L
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PMEEQDNEESEKRRKKKKGTKRKRDGRGQEGTLAYDLKLDDMLDRTLEDGAKQHNLTAVNVRNILHEVITNEHVVAMMKAAISETEDMPMFEPKMTRSKLKEVV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining