missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30198339

Invitrogen™ Human GOLGB1 (aa 1778-1906) Control Fragment Recombinant Protein

Product Code. 30198339
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198339

Brand: Invitrogen™ RP90448

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52772 (PA5-52772. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Golgin subfamily B member 1 (GOLGB1) is a single pass type I membrane protein located in the golgi apparatus membrane. GOLGB1 may participate in forming intercisternal cross-bridges of the Golgi complex.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q14789
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2804
Name Human GOLGB1 (aa 1778-1906) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 372 kDa Golgi complex-associated protein; 4930428L02Rik; 628101; 6330407A06Rik; AU042952; C130074L01Rik; F730017E11Rik; GCP; GCP372; Giantin; Gm6840; GOLGB1; golgi autoantigen, golgin subfamily b, macrogolgin (with transmembrane signal), 1; golgi autoantigen, golgin subfamily b, macrogolgin 1; golgi integral membrane protein 1; golgi-associated protein GCP360; golgin B1; golgin B1, golgi integral membrane protein; golgin subfamily B member 1; Golgin subfamily B member 1; LOW QUALITY PROTEIN: golgin subfamily B member 1; golgin subfamily b member 1-like protein; GOLIM1; LOW QUALITY PROTEIN: golgin subfamily B member 1; macrogolgin; mKIAA4151
Common Name GOLGB1
Gene Symbol GOLGB1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KHDNQTNVTEEGTQSIPGETEEQDSLSMSTRPTCSESVPSAKSANPAVSKDFSSHDEINNYLQQIDQLKERIAGLEEEKQKNKEFSQTLENEKNTLLSQISTKDGELKMLQEEVTKMNLLNQQIQEELS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.