missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GOLGA6A (aa 560-593) Control Fragment Recombinant Protein

Product Code. 30202648
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202648

Brand: Invitrogen™ RP104375

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (35%), Rat (35%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60880 (PA5-60880. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. The protein encoded by this gene is a member of the golgin family of proteins, whose members localize to the Golgi. This gene is found in a large, low copy repeat sequence or duplicon that is found in multiple copies, that are greather than 90% similar, on chromosome 15. Duplicons are associated with deletions, inversions and other chromosome rearrangements that underlie genomic disease. The protein encoded by this gene is thought to be a functional golgin protein while the majority of the related copies of this gene are thought to be transcribed pseudogenes. [provided by RefSeq, Jul 2008].
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NYA3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 342096
Name Human GOLGA6A (aa 560-593) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias GLP; GOLGA6; GOLGA6A; golgi autoantigen, golgin subfamily a, 6; golgi autoantigen, golgin subfamily a, 6 A; golgi autoantigen, golgin subfamily a, member 6; golgin A6 family member A; golgin A6 family, member A; Golgin linked to PML; Golgin subfamily A member 6 A; golgin-like protein
Common Name GOLGA6A
Gene Symbol GOLGA6A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GVTDGMRESFTVYESQGAVPNTRHQEMEDVIRLA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.