Invitrogen™ Human GOLGA4 (aa 1290-1380) Control Fragment Recombinant Protein

Product Code. 30195350

Brand: Invitrogen™ RP108831

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. This gene encodes one of the golgins, a family of proteins localized to the Golgi. This protein has been postulated to play a role in Rab6-regulated membrane-tethering events in the Golgi apparatus. Alternatively spliced transcript variants encoding different isoforms have been identified in this gene.

Specifications

• Accession Number: Q13439
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2803
• Name: Human GOLGA4 (aa 1290-1380) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 256 kDa golgin; 72.1 protein; AI225887; AU019508; centrosome-related protein F46; CRPF46; EMBL:AAH85124.1, ECO:0000312; GCP2; GOLG; Golga4; golga4 {ECO:0000312; golgi autoantigen, golgin subfamily a, 4; golgin A4; Golgin subfamily A member 4; golgin subfamily A member 4 {ECO:0000250; golgin-240; golgin-245; MU-RMS-40.18; Olp-1; p230; protein 72.1; RGD:1591925}; tGolgin-1; trans-Golgi p230; UniProtKB:Q13439}
• Common Name: GOLGA4
• Gene Symbol: GOLGA4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ISFQQATHQLEEKENQIKSMKADIESLVTEKEALQKEGGNQQQAASEKESCITQLKKELSENINAVTLMKEELKEKKVEISSLSKQLTDLN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining