missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30182179

Invitrogen™ Human GOLGA3 (aa 555-655) Control Fragment Recombinant Protein

Produktkod. 30182179
Klicka för att se tillgängliga alternativ
Quantity:
100 μL
Förpackningsstorlek:
100µL
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 30182179

Brand: Invitrogen™ RP97683

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59041 (PA5-59041. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of kinesin-like protein family. Proteins of this family are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. This protein is important for anaphase chromosome segregation and may be required to coordinate the onset of sister centromere separation.
TRUSTED_SUSTAINABILITY

Specifikationer

Accession Number Q08378
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2802
Name Human GOLGA3 (aa 555-655) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5330413L04; 5430416E01Rik; AI449376; AW490576; G1-499-14; GCP170; GOLGA3; golgi autoantigen, golgin subfamily a, 3; golgi complex-associated protein of 170 kDa; Golgi membrane associated protein; Golgi peripheral membrane protein; golgin A3; Golgin subfamily A member 3; Golgin-160; golgin-165; HGNC:4426; male enhanced antigen-2; male-enhanced antigen 2; Mea2; MEA-2; Mea2/Golga3; repro27; SY2/SY10 protein
Common Name GOLGA3
Gene Symbol Golga3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TTLTSKLKASQAEISSLQSVRQWYQQQLALAQEARVRLQGEMAHIQVGQMTQAGLLEHLKLENVSLSQQLTETQHRSMKEKGRIAAQLQGIEADMLDQEAA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.