Invitrogen™ Human GNS (aa 183-296) Control Fragment Recombinant Protein

Product Code. 30197983

Brand: Invitrogen™ RP103028

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111276 (PA5-111276. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GNS is a lysosomal enzyme found in all cells. It is involved in the catabolism of heparin, heparan sulphate, and keratan sulphate. Deficiency of this enzyme results in the accumulation of undegraded substrate and the lysosomal storage disorder mucopolysaccharidosis type IIID (Sanfilippo D syndrome). Mucopolysaccharidosis type IIID is the least common of the four subtypes of Sanfilippo syndrome.

Specifications

• Accession Number: P15586
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2799
• Name: Human GNS (aa 183-296) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610016K11Rik; AU042285; C87209; G6S; glucosamine (N-acetyl)-6-sulfatase; glucosamine (N-acetyl)-6-sulfatase (Sanfilippo disease IIID); glucosamine -6-sulfatase; glucosamine-6-sulfatase; Gns; N28088; N-acetylglucosamine 6-sulfatase precursor; N-acetylglucosamine-6-sulfatase
• Common Name: GNS
• Gene Symbol: GNS
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NYTLSINGKARKHGENYSVDYLTDVLANVSLDFLDYKSNFEPFFMMIATPAPHSPWTAAPQYQKAFQNVFAPRNKNFNIHGTNKHWLIRQAKTPMTNSSIQFLDNAFRKRWQTL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining