Invitrogen™ Human GNL2 (aa 166-236) Control Fragment Recombinant Protein

Product Code. 30202168

Brand: Invitrogen™ RP105145

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66303 (PA5-66303. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GTPase that associates with pre-60S ribosomal subunits in the nucleolus and is required for their nuclear export and maturation. May promote cell proliferation possibly by increasing p53/TP53 protein levels, and consequently those of its downstream product CDKN1A/p21, and decreasing RPL23A protein levels (PubMed:26203195). [UniProt]

Specifications

• Accession Number: Q13823
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 29889
• Name: Human GNL2 (aa 166-236) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Autoantigen NGP-1; BC003262; G protein nucleolar 2; GNL2; guanine nucleotide binding protein-like 2 (nucleolar); HUMAUANTIG; NGP1; Ngp-1; Nog2; novel nucleolar guanosine 5'-triphosphate binding protein autoantigen; nucleolar G-protein gene 1; nucleolar GTPase; nucleolar GTP-binding protein 2; nucleostemin-2; Nug2; RGD1305006; testicular antigen
• Common Name: GNL2
• Gene Symbol: GNL2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NAEMSTESYDQGKDRDLVTEDTGVRNEAQEEIYKKGQSKRIWGELYKVIDSSDVVVQVLDARDPMGTRSPH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining