Invitrogen™ Human GNG5 (aa 31-67) Control Fragment Recombinant Protein

Artikelnummer. 30181295

missing translation for 'mfr': Invitrogen™ RP99261

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60452 (PA5-60452. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

G proteins are trimeric (alpha-beta-gamma) membrane-associated proteins that regulate flow of information from cell surface receptors to a variety of internal metabolic effectors. Interaction of a G protein with its activated receptor promotes exchange of GTP for GDP that is bound to the alpha subunit. The alpha-GTP complex dissociates from the beta-gamma heterodimer so that the subunits, in turn, may interact with and regulate effector molecules (Gilman, 1987 [PubMed 3113327];Summary by Ahmad et al., 1995) [PubMed 7606925].[supplied by OMIM, Nov 2010].

Spezifikation

• Accession Number: P63218
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2787
• Name: Human GNG5 (aa 31-67) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: G protein gamma-5 subunit; G protein subunit gamma 5; G(y)5; GNG5; Gngt5; guanine nucleotide binding protein (G protein), gamma 5; guanine nucleotide binding protein (G protein), gamma 5 subunit; guanine nucleotide binding protein gamma 5; guanine nucleotide-binding protein G(I)/G/G(O) subunit gamma-5
• Common Name: GNG5
• Gene Symbol: GNG5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVCSF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining