missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GNAS (aa 13-99) Control Fragment Recombinant Protein

Product Code. 30207752
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30207752

Brand: Invitrogen™ RP95101

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Mutations in GNAS gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseous heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors. This gene has a highly complex imprinted expression pattern. It encodes maternally, paternally, and biallelically expressed proteins which are derived from alternatively spliced transcripts with alternate 5' exons. Each of the upstream exons is within a differentially methylated region, commonly found in imprinted genes. However, the close proximity (14 kb) of two oppositely expressed promoter regions is unusual. In addition, one of the alternate 5' exons introduces a frameshift relative to the other transcripts, resulting in one isoform which is structurally unrelated to the others. An antisense transcript exists, and may regulate imprinting in this region. Mutations in this gene result in pseudohypoparathyroidism type 1a (PHP1a), which has an atypical autosomal dominant inheritance pattern requiring maternal transmission for full penetrance.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O95467, P63092, P84996, Q5JWF2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2778
Name Human GNAS (aa 13-99) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5530400H20Rik; A930027G11Rik; Adenylate cyclase-stimulating G alpha protein; AHO; ALEX; GNAS; NESP55; alpha-stimulatory subunit of GTP-binding protein; alternative gene product encoded by XL-exon; C130027O20Rik; C20orf45; dJ309F20.1.1; dJ806M20.3.3; Extra large alphas protein; G protein alpha subunit; G protein subunit alpha S; GAIPIRRH peptide; G-alpha-8; Galphas; Gnas; GNAS (guanine nucleotide binding protein, alpha stimulating) complex locus; gnas {ECO:0000312; GNAS complex locus; GNAS complex locus; SCG6 (secretogranin VI); GNAS1; Gnasxl; Gnpas; GPIPIRRH peptide; GPSA; Gs alpha subunit; GSA; G-SALPHA60A; GSP; GTP-binding regulatory protein (G-s-alpha).; GTP-binding regulatory protein alpha subunit exon 1; guanine nucleotide binding protein (G protein), alpha stimulating activity polypeptide 1; guanine nucleotide binding protein alpha s; guanine nucleotide binding protein alpha subunit; guanine nucleotide binding protein, alpha stimulating activity polypeptide 1; guanine nucleotide regulatory protein; guanine nucleotide-binding protein G(s) subunit alpha; guanine nucleotide-binding protein G(s) subunit alpha isoforms; Guanine nucleotide-binding protein G(s) subunit alpha isoforms short; Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas; guanine nucleotide-binding protein G(s) subunit alpha; guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas; guanine nucleotide-binding protein G(s) subunit alpha; SCG6 (secretogranin VI); guanine nucleotide-binding protein G(s), alpha subunit; guanine nucleotide-binding protein Gs alpha1; guanine nucleotide-binding protein G-s, alpha subunit; guanine nucleotide-binding protein, alpha-stimulating activity polypeptide 1; LHAL tetrapeptide; LSAL tetrapeptide; MGC33735; MNCb-5546; Nesp; NESP55; Nespl; neuroendocrine secretory protein; neuroendocrine secretory protein 55; Oedsml; Oed-Sml; OTTHUMP00000031742; OTTHUMP00000196026; OTTHUMP00000196030; P1; P2; P3; PHP1A; PHP1B; PHP1C; POH; PORGSA1; Protein ALEX; protein ALEX; protein GNAS; protein NESP55; protein ALEX; protein GNAS; protein SCG6 (secretogranin VI); RGD:2716}; RP4-543J19.4; SCG6; secretogranin VI; SgVI; stimulatory G-protein alpha subunit; stimulatory GTP binding protein; unnamed protein product; XLalphas; XLas
Common Name GNAS
Gene Symbol GNAS
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SGQRDIPPEIGEQPEQPPLEAPGAAAPGAGPSPAEEMETEPPHNEPIPVENDGEACGPPEVSRPNFQVLNPAFREAGAHGSYSPPPE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.