Invitrogen™ Human GNAL (aa 111-152) Control Fragment Recombinant Protein

Product Code. 30208392

Brand: Invitrogen™ RP108391

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84051 (PA5-84051. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. G(olf) alpha mediates signal transduction within the olfactory neuroepithelium and the basal ganglia. May be involved in some aspect of visual transduction, and in mediating the effect of one or more hormones/neurotransmitters.

Specifications

• Accession Number: P38405
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2774
• Name: Human GNAL (aa 111-152) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610011C15Rik; 9630020G10Rik; adenylate cyclase-stimulating G alpha protein, olfactory type; DYT25; G alpha 10; G protein subunit alpha L; Galphaolf; Gna10; Gnal; Golf; guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type; guanine nucleotide binding protein (G protein), alpha stimulating activity polypeptide, olfactory type; guanine nucleotide binding protein, alpha 10; guanine nucleotide binding protein, alpha stimulating, olfactory type; guanine nucleotide-binding protein G(olf) subunit alpha; guanine nucleotide-binding protein G(olf), alpha subunit; Olf; olfa; Olf-alpha protein (olfactory neuron-specific G protein); RGD1305940
• Common Name: GNAL
• Gene Symbol: Gnal
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NQFRSDYIKSIAPITDFEYSQEFFDHVKKLWDDEGVKACFER
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining