Invitrogen™ Human GMNN (aa 39-100) Control Fragment Recombinant Protein

Product Code. 30198119

Brand: Invitrogen™ RP106554

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GMNN inhibits DNA replication by preventing the incorporation of MCM complex into prereplication complex (pre-RC). It is degraded during the mitotic phase of the cell cycle. Its destruction at the metaphase-anaphase transition permits replication in the succeeding cell cycle.

Specifications

• Accession Number: O75496
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51053
• Name: Human GMNN (aa 39-100) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW546347; Gem; geminin; Geminin GMNN; geminin, DNA replication inhibitor; GMNN; MGORS6; OTTHUMP00000039393; RP3 369A17.3
• Common Name: GMNN
• Gene Symbol: GMNN
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GRENELSAGLSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining