missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30197169

Invitrogen™ Human GMFB (aa 2-109) Control Fragment Recombinant Protein

Product Code. 30197169
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30197169

Brand: Invitrogen™ RP89059

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51787 (PA5-51787. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This protein, which is phosphorylated following phorbol ester stimulation, is important for the nervous system. It causes brain cell differentiation, stimulates neural regeneration and inhibits tumor cell proliferation. Overexpression of GMF in astrocytes has been shown to enhance brain-derived neurotrohic factor (BDNF) production. GMF expression is increased by exercise, and the protein is crucial for exercise-induction of BDNF. Through BDNF production, GMF appears to play a role in neuroprotection. In thymoma, T-cell development is maintained by GMF; being produced by the tumor cells.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P60983
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2764
Name Human GMFB (aa 2-109) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 3110001H22Rik; 3110001O16Rik; AI851627; C79176; D14Ertd630e; DNA for thyroid hormone receptor binding site (276 bp); glia maturation factor beta; glia maturation factor beta-like protein; glia maturation factor, beta; GMF; Gmfb; GMF-beta
Common Name GMFB
Gene Symbol Gmfb
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.