missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30204596

Invitrogen™ Human GlyT1 (aa 219-285) Control Fragment Recombinant Protein

Product Code. 30204596
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30204596

Brand: Invitrogen™ RP90688

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53103 (PA5-53103. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Slc6a9 is a glycine transporter (GlyTs) that belong to a family of high affinity Na+- and Cl-dependent neurotransmitter transporters proteins. There are two subtypes of glycine transporters; GlyT1 (Slc6a9) and GlyT2. Slc6a9 are predominantly located on glia within caudal brain areas. The amino acid glycine acts as an inhibitory neurotransmitter in the central nervous system. The protein encoded by the Slc6a9 gene is one of two transporters that stop glycine signaling by removing it from the synaptic cleft. Diseases associated with SLC6A9 include Glycine Encephalopathy With Normal Serum Glycine and Infantile Glycine Encephalopathy.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P48067
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6536
Name Human GlyT1 (aa 219-285) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias glycine transporter; glycine transporter 1; glycine transporter variant 1 A; glycine-1 transporter; GLYT1; glyT-1; GLYT-1 b; Slc6a9; Sodium- and chloride-dependent glycine transporter 1; solute carrier family 6 (neurotransmitter transporter, glycine), member 9; solute carrier family 6 member 9
Common Name GlyT1
Gene Symbol SLC6A9
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YCNNPWNTHDCAGVLDASNLTNGSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.