missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30193956

Invitrogen™ Human GLYR1 (aa 355-440) Control Fragment Recombinant Protein

Product Code. 30193956
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30193956

Brand: Invitrogen™ RP103065

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62141 (PA5-62141. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GLYR1 may have oxidoreductase activity. It regulates p38 MAP kinase activity by mediating stress activation of p38alpha/MAPK14 and specifically regulating MAPK14 signaling. It indirectly promotes phosphorylation of MAPK14 and activation of ATF2. The phosphorylation of MAPK14 requires upstream activity of MAP2K4 and MAP2K6. It is recruited on chromatin, recognizes and binds trimethylated 'Lys-36' of histone H3 (H3K36me3).
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q49A26
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 84656
Name Human GLYR1 (aa 355-440) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2810419J22Rik; 3930401k13rik; 3-hydroxyisobutyrate dehydrogenase-like protein; AW545332; BM045; Cytokine-like nuclear factor N-PAC; glyoxylate reductase 1 homolog; glyoxylate reductase 1 homolog (Arabidopsis); GLYR1; HIBDL; hNDF; NDF; NP60; Npac; N-pac; nuclear protein 60 kDa; nuclear protein 60 kDa; nuclear protein NP60; Nuclear protein of 60 kDa; Nucleosome-destabilizing factor; Putative oxidoreductase GLYR1; RGD1309459
Common Name GLYR1
Gene Symbol GLYR1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.