Invitrogen™ Human Glypican 4 (aa 473-533) Control Fragment Recombinant Protein

Product Code. 30201339

Brand: Invitrogen™ RP95430

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. The GPC4 gene is adjacent to the 3' end of GPC3 and may also play a role in Simpson-Golabi-Behmel syndrome.

Specifications

• Accession Number: O75487
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2239
• Name: Human Glypican 4 (aa 473-533) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9530073D23Rik; AF311610; AI385680; AI661372; dJ900E8.1 (glypican 4); glypican 4; glypican proteoglycan 4; glypican-4; Gpc4; K-glypican; Secreted glypican-4; UNQ474/PRO937
• Common Name: Glypican 4
• Gene Symbol: GPC4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SKMKNAYNGNDVDFFDISDESSGEGSGSGCEYQQCPSEFDYNATDHAGKSANEKADSAGVR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining