Invitrogen™ Human GLYATL3 (aa 207-278) Control Fragment Recombinant Protein

Product Code. 30208948

Brand: Invitrogen™ RP100309

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60602 (PA5-60602. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Catalyzes the conjugation of long-chain fatty acyl-CoA thioester and glycine to produce long-chain N-(fatty acyl)glycine, an intermediate in the primary fatty acid amide biosynthetic pathway. [UniProt]

Specifications

• Accession Number: Q5SZD4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 389396
• Name: Human GLYATL3 (aa 207-278) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Acyl-CoA:glycine-N-acyltransferase-like protein 3; bA28H17.2; C6orf140; EG435528; GLYATL3; Glycine N-acyltransferase-like protein 3; glycine N-acyltransferase-like protein 3-like; glycine-N-acyltransferase like 3; glycine-N-acyltransferase-like 3; Glycine-N-acyltransferase-like protein 3; Gm5683; LOW QUALITY PROTEIN: glycine N-acyltransferase-like protein 3
• Common Name: GLYATL3
• Gene Symbol: GLYATL3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DQFATMCHGYTLPEHRRKGYSRLVALTLARKLQSRGFPSQGNVLDDNTASISLLKSLHAEFLPCRFHRLILT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining