Invitrogen™ Human GLYATL2 (aa 85-180) Control Fragment Recombinant Protein

Product Code. 30205624

Brand: Invitrogen™ RP97406

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (36%), Rat (36%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63835 (PA5-63835. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GLYATL2 belongs to the glycine N-acyltransferase family. GLYATL2 is a mitochondrial acyltransferase which transfers the acyl group to the N-terminus of glycine. It can conjugate a multitude of substrates to form a variety of N-acylglycines.

Specifications

• Accession Number: Q8WU03
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 219970
• Name: Human GLYATL2 (aa 85-180) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: acyl-CoA:glycine N-acyltransferase-like protein 2; BXMAS2-10; GATF-B; GLYATL2; glycine acyltransferase family-B; glycine N-acyltransferase-like protein 2; glycine-N-acyltransferase like 2; glycine-N-acyltransferase-like 2
• Common Name: GLYATL2
• Gene Symbol: GLYATL2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LEEVLSYSNVISWEQTLQIQGCQEGLDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNKEGNFSNMFLDASHAGLVNEHW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining