Invitrogen™ Human GluR6 (aa 852-905) Control Fragment Recombinant Protein

Product Code. 30211190

Brand: Invitrogen™ RP91016

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glutamate receptors are the primary excitatory neurotransmitter receptors in the mammalian brain and are activated during various normal neurophysiological processes. The kainate family of glutamate receptors, which are composed of four subunits and function as ligand-activated ion channels, includes this gene product. The subunit encoded by this gene is edited at multiple sites within the first and second transmembrane domains, which is thought to alter the structure and function of the receptor complex. Furthermore, different isoforms of this gene have been described due to alternatively spliced transcript variants. Mutations in this gene have been linked to autosomal recessive cognitive disability. GRIK2-associated diseases include Neurodevelopmental Disorder with Impaired Language and Ataxia and with or without Seizures and Intellectual Developmental Disorder, Autosomal Recessive 6.

Specifications

• Accession Number: Q13002
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2898
• Name: Human GluR6 (aa 852-905) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW124492; bA487F5.1; EAA4; Excitatory amino acid receptor 4; GLR 6; GLR6; GluK2; GLUK6; GLUR 6; gluR beta-2; Glur6; Glur-6; Glurbeta2; glutamate ionotropic receptor kainate type subunit 2; glutamate receptor; glutamate receptor 6; Glutamate receptor beta-2; glutamate receptor form A; glutamate receptor form B; glutamate receptor form C; glutamate receptor form D; glutamate receptor form E; glutamate receptor ionotropic, kainate 2; glutamate receptor, ionotropic kainate 2; glutamate receptor, ionotropic, kainate 2; glutamate receptor, ionotropic, kainate 2 (beta 2); glutamate receptor, ionotropic, kainate 5; GRIK 2; Grik2; GRIK2 protein; grik2alpha; grik2l; MRT6
• Common Name: GluR6
• Gene Symbol: GRIK2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LEKRSFCSAMVEELRMSLKCQRRLKHKPQAPVIVKTEEVINMHTFNDRRLPGKE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining