missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GluR6 (aa 375-467) Control Fragment Recombinant Protein

Product Code. 30195396
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30195396

Brand: Invitrogen™ RP91015

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110793 (PA5-110793. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glutamate receptors are the primary excitatory neurotransmitter receptors in the mammalian brain and are activated during various normal neurophysiological processes. The kainate family of glutamate receptors, which are composed of four subunits and function as ligand-activated ion channels, includes this gene product. The subunit encoded by this gene is edited at multiple sites within the first and second transmembrane domains, which is thought to alter the structure and function of the receptor complex. Furthermore, different isoforms of this gene have been described due to alternatively spliced transcript variants. Mutations in this gene have been linked to autosomal recessive cognitive disability. GRIK2-associated diseases include Neurodevelopmental Disorder with Impaired Language and Ataxia and with or without Seizures and Intellectual Developmental Disorder, Autosomal Recessive 6.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q13002
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2898
Name Human GluR6 (aa 375-467) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AW124492; bA487F5.1; EAA4; Excitatory amino acid receptor 4; GLR 6; GLR6; GluK2; GLUK6; GLUR 6; gluR beta-2; Glur6; Glur-6; Glurbeta2; glutamate ionotropic receptor kainate type subunit 2; glutamate receptor; glutamate receptor 6; Glutamate receptor beta-2; glutamate receptor form A; glutamate receptor form B; glutamate receptor form C; glutamate receptor form D; glutamate receptor form E; glutamate receptor ionotropic, kainate 2; glutamate receptor, ionotropic kainate 2; glutamate receptor, ionotropic, kainate 2; glutamate receptor, ionotropic, kainate 2 (beta 2); glutamate receptor, ionotropic, kainate 5; GRIK 2; Grik2; GRIK2 protein; grik2alpha; grik2l; MRT6
Common Name GluR6
Gene Symbol GRIK2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.