missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GluR1 (aa 344-406) Control Fragment Recombinant Protein

Product Code. 30196680
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196680

Brand: Invitrogen™ RP95665

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GluR1 (glutamate receptor 1) is an ionotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter, L-glutamate, induces a conformation change that leads to the opening of the cation channel and converts the chemical signal to an electrical impulse. Then, the receptor desensitizes rapidly and enters a transiet inactive state characterized by the presence of a bound agonist. In the presence of CACNG4, CACNG7, or CACNG8 GluR1 shows resensitization which is characterized by a delayed accumulation of current flux upon continued application of glutamate.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P42261
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2890
Name Human GluR1 (aa 344-406) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2900051M01Rik; AI853806; AMPA 1; AMPA glutamate receptor; AMPA receptor GluR1/A; AMPA-selective glutamate receptor 1; Glr1; Glr-1; GluA1; GLUH 1; GLUH1; GluR K1; GLUR1; Glur-1; GluR1 flip; GluR1 flop; GLURA; GluR-A; GluRK1; gluR-K1; glutamate ionotropic receptor AMPA type subunit 1; glutamate receptor; glutamate receptor 1; glutamate receptor A; glutamate receptor ionotropic, AMPA 1; glutamate receptor subunit GluR1; glutamate receptor, ionotropic, AMPA 1; glutamate receptor, ionotropic, AMPA1 (alpha 1); GPRC1A; Gria 1; Gria1; GRM1A; HBGR1; HGBR1; HIPA; HIPA1; MGC13325; MGC133252; NMDA1; NMDAR1; NR1; OTTHUMP00000160643; OTTHUMP00000165781; OTTHUMP00000224241; OTTHUMP00000224242; OTTHUMP00000224243; RP11-350O14.1
Common Name GluR1
Gene Symbol GRIA1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.