Invitrogen™ Human GluR1 (aa 344-406) Control Fragment Recombinant Protein

Product Code. 30196680

Brand: Invitrogen™ RP95665

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GluR1 (glutamate receptor 1) is an ionotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter, L-glutamate, induces a conformation change that leads to the opening of the cation channel and converts the chemical signal to an electrical impulse. Then, the receptor desensitizes rapidly and enters a transiet inactive state characterized by the presence of a bound agonist. In the presence of CACNG4, CACNG7, or CACNG8 GluR1 shows resensitization which is characterized by a delayed accumulation of current flux upon continued application of glutamate.

Specifications

• Accession Number: P42261
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2890
• Name: Human GluR1 (aa 344-406) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2900051M01Rik; AI853806; AMPA 1; AMPA glutamate receptor; AMPA receptor GluR1/A; AMPA-selective glutamate receptor 1; Glr1; Glr-1; GluA1; GLUH 1; GLUH1; GluR K1; GLUR1; Glur-1; GluR1 flip; GluR1 flop; GLURA; GluR-A; GluRK1; gluR-K1; glutamate ionotropic receptor AMPA type subunit 1; glutamate receptor; glutamate receptor 1; glutamate receptor A; glutamate receptor ionotropic, AMPA 1; glutamate receptor subunit GluR1; glutamate receptor, ionotropic, AMPA 1; glutamate receptor, ionotropic, AMPA1 (alpha 1); GPRC1A; Gria 1; Gria1; GRM1A; HBGR1; HGBR1; HIPA; HIPA1; MGC13325; MGC133252; NMDA1; NMDAR1; NR1; OTTHUMP00000160643; OTTHUMP00000165781; OTTHUMP00000224241; OTTHUMP00000224242; OTTHUMP00000224243; RP11-350O14.1
• Common Name: GluR1
• Gene Symbol: GRIA1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining