missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Glucagon (aa 21-95) Control Fragment Recombinant Protein

Product Code. 30211438
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211438

Brand: Invitrogen™ RP102745

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83352 (PA5-83352. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glucagon is a 29-residue polypeptide hormone (MW 3482), produced in the pancreas. A related hormone, enteroglucagon (or oxyntomodulin), which is produced in the mucosa of the small and large intestine, consists of the 29 amino acid sequence of pancreatic glucagon extended by 8 additional residues at the C-terminus. The biological activities of pancreatic glucagon include glycogenolysis, lipolysis, gluconeogenesis, and ketogensis, which are antagonistic effects to those of insulin action, thus leading to increased blood glucose levels. Immunocytochemical studies have revealed the presence of pancreatic glucagon inside the A or alpha cells, which constitute 15-20% of the islet cell population. These cells are located preferentially at the periphery of the human pancreatic islets. Pathological manifestations of the glucagon-type peptide residue almost exclusively with the exsistence of tumors or glucagonomas, as no states of glucagon-cell deficiency or hyperplasia have been identified. Glucagon-specific antibodies would prove useful as a cell and tumor markers applying immunohistochemical techniques, and as an analytical tool in qualification of the hormone.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P01275
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2641
Name Human Glucagon (aa 21-95) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias GCG; Glicentin; Glicentin-related polypeptide; GLP1; GLP-1; GLP-1(7-36); GLP-1(7-37); GLP1/2; GLP2; GLP-2; Glu; glucagon; Glucagon-like peptide 1; Glucagon-like peptide 1(7-36); Glucagon-like peptide 1(7-37); Glucagon-like peptide 2; glucagon-like peptide-1; GRPP; IL12p35; IL12P40; Incretin hormone; OXM; OXY; Oxyntomodulin; porcine proglucagon; PPG; preproglucagon; proglucagon
Common Name Glucagon
Gene Symbol Gcg
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.