Invitrogen™ Human GLT8D4 (aa 273-314) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30204806	100 μL	100µL

Product Code. 30204806 Supplier Invitrogen™ Supplier No. RP103823

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64369 (PA5-64369. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glycosyltransferase which elongates the O-linked glucose attached to EGF-like repeats in the extracellular domain of Notch proteins by catalyzing the addition of xylose.

Specifications

• Accession Number: A0PJZ3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 727936
• Name: Human GLT8D4 (aa 273-314) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 242n2; GLT8D4; Glucoside xylosyltransferase 2; glycosyltransferase 8 domain containing 4; glycosyltransferase 8 domain-containing protein 4; GXYLT2
• Common Name: GLT8D4
• Gene Symbol: GXYLT2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MNLTRIRSTQFKNSMIPTGLAWEDMLYPLYQKYKNAITWGDQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining