missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210832

Invitrogen™ Human GLRB (aa 353-471) Control Fragment Recombinant Protein

Product Code. 30210832
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210832

Brand: Invitrogen™ RP91139

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62593 (PA5-62593. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

In the central nervous system (CNS), glycine-mediated inhibitory neurotransmission is essential to voluntary motor control and reflex responses. Glycine binds to glycine receptors (GlyR) in the postsynaptic neuronal membranes. GlyR, gamma-aminobutryic acid, serotonin and acetylcholine comprise an evolutionally conserved superfamily of ligand-gated ion channels. The pentameric subunit structure of GlyR consists of two types of glycosylated membrane proteins, alpha1 through alpha4 and beta, and an associated peripheral membrane protein, which combine to form a chloride-selective ion channel. In humans, the composition of the pentamer changes from alpha2 subunits in the fetal CNS to alpha1 and beta subunits in the adult CNS. Fast potentiation of GlyR by intracellular Ca2+ in the brainstem and midbrain indicate an important role for Ca2+ in modulation of glycinergic synapses.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P48167
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2743
Name Human GLRB (aa 353-471) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI853901; Glrb; glycine receptor; Glycine receptor 58 kDa subunit; glycine receptor beta; glycine receptor subunit beta; glycine receptor, beta; glycine receptor, beta subunit; GlyR beta; Glyrb; HKP x 2; inhibitory glycine receptor; spa; spastic
Common Name GLRB
Gene Symbol GLRB
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MLNNPKRVEAEKARIAKAEQADGKGGNVAKKNTVNGTGTPVHISTLQVGETRCKKVCTSKSDLRSNDFSIVGSLPRDFELSNYDCYGKPIEVNNGLGKSQAKNNKKPPPAKPVIPTAAK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.