Invitrogen™ Human GLRA4 Control Fragment Recombinant Protein

Product Code. 30209939

Brand: Invitrogen™ RP100486

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60817 (PA5-60817. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glra4 is a member of glycine receptors (GlyR), a cys-loop family of ligand-gated ion channels responsible for mediating the inhibitory effects of glycine. GlyR are widely distributed throughout the CNS, particularly within the hippocampus, spinal cord and brain stem. Glycine receptors are ligand-gated chloride channels. Channel opening is triggered by extracellular glycine and channel opening is also triggered by taurine and beta-alanine. Glra4 plays a role in the down-regulation of neuronal excitability, and contributes to the generation of inhibitory postsynaptic currents. The Glra4 gene encodes a protein which has a neurotransmitter-gated ion-channel ligand binding domain. Glra4 protein is very similar to a mouse protein which is a subunit of the retinal glycine receptor. Multiple transcript variants encoding different isoforms have been found for the Glra4 gene. Diseases associated with GLRA4 include Pelizaeus-Merzbacher Disease.

Specifications

• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 441509
• Name: Human GLRA4 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Glra4; glycine receptor alpha 4; glycine receptor subunit alpha-4; glycine receptor, alpha 4; glycine receptor, alpha 4 subunit; RGD1564103
• Common Name: GLRA4
• Gene Symbol: GLRA4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IRLRRRQRRQRLEEDIIQESRFYFRGYGLGHCLQARDGGPMEGSGIYSPQPPAPLLREGETTRKLYVD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining