Invitrogen™ Human GLMN (aa 135-234) Control Fragment Recombinant Protein

Product Code. 30210554

Brand: Invitrogen™ RP94462

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111021 (PA5-111021. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a phosphorylated protein that is a member of a Skp1-Cullin-F-box-like complex. The protein is essential for normal development of the vasculature and mutations in this gene have been associated with glomuvenous malformations, also called glomangiomas. Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only one has been determined.

Specifications

• Accession Number: Q92990
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 11146
• Name: Human GLMN (aa 135-234) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9330160J16Rik; AW227515; FAP; Fap48; FAP68; FK506-binding protein-associated protein; FKBP associated protein; FKBPAP; FKBP-associated protein; GLML; Glmn; Glomulin; glomulin, FKBP associated protein; glomulin-like protein; GVM; LOW QUALITY PROTEIN: glomulin; VMGLOM
• Common Name: GLMN
• Gene Symbol: GLMN
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KLHNKAYSIGLALSTLWNQLSLLPVPYSKEQIQMDDYGLCQCCKALIEFTKPFVEEVIDNKENSLENEKLKDELLKFCFKSLKCPLLTAQFFEQSEEGGN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining