Invitrogen™ Human GLIPR1L2 (aa 47-131) Control Fragment Recombinant Protein

Product Code. 30180682

Brand: Invitrogen™ RP97860

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58932 (PA5-58932. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the cysteine-rich secretory protein, antigen 5, and pathogenesis-related 1 superfamily. Members of this family have roles in a variety of processes, including cancer and immune defense. This gene is located in a cluster with two related genes on chromosome 12. Alternative splicing results in multiple transcript variants.

Specifications

• Accession Number: Q4G1C9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 144321
• Name: Human GLIPR1L2 (aa 47-131) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: GLI pathogenesis related 1 like 2; GLI pathogenesis-related 1 like 2; GLIPR1 like 2; GLIPR1L2; GLIPR1-like protein 2; RGD1310205
• Common Name: GLIPR1L2
• Gene Symbol: GLIPR1L2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DEEDVDFINEYVNLHNELRGDVIPRGSNLRFMTWDVALSRTARAWGKKCLFTHNIYLQDVQMVHPKFYGIGENMWVGPENEFTAS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining