Invitrogen™ Human GLE1 (aa 110-210) Control Fragment Recombinant Protein

Product Code. 30180497

Brand: Invitrogen™ RP98406

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83571 (PA5-83571. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The proper expression of gene products in eukaryotic cells relies on efficient transport of mRNA molecules out of the nucleus. Gle1 is an essential mRNA export factor in both human and yeast cells. It associates with the nuclear pore complex (NPC) through hCG1 and NUP155 in mammalian cells and in conjunction with inositol hexakisphosphate (IP6), stimulates Dbp5, a member of the DEAD-box helicase family, triggering mRNP remodeling and facilitating RNA export from the nucleus. Recent evidence suggests that mutations in Gle1 causing defects in mRNA export can result in human disease. At least three isoforms of Gle1 are known to exist.

Specifications

• Accession Number: Q53GS7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2733
• Name: Human GLE1 (aa 110-210) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4933405K21Rik; AA553313; GLE1; GLE1 RNA export mediator; GLE1 RNA export mediator (yeast); GLE1 RNA export mediator homolog; GLE1 RNA export mediator-like (yeast; GLE1, RNA export mediator; GLE1L; GLE1-like protein; GLE1-like, RNA export mediator; hGLE1; LCCS; LCCS1; Nucleoporin GLE1
• Common Name: GLE1
• Gene Symbol: GLE1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DESQHTESMVLQSSRGIKVEGCVRMYELVHRMKGTEGLRLWQEEQERKVQALSEMASEQLKRFDEWKELKQHKEFQDLREVMEKSSREALGHQEKLKAEHR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining