Invitrogen™ Human GLAST (aa 497-541) Control Fragment Recombinant Protein

Product Code. 30199056

Brand: Invitrogen™ RP96857

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of a member of a high affinity glutamate transporter family. Mutations in this gene are associated with episodic ataxia, Type 6. Alternative splicing results in multiple transcript variants.

Specifications

• Accession Number: P43003
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6507
• Name: Human GLAST (aa 497-541) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI504299; B430115D02Rik; EA6; Eaat1; EAAT-1; Excitatory amino acid transporter 1; FLJ25094; GLAST; GLAST1; GLAST-1; Glial glutamate transporter; glial high affinity glutamate transporter; GLU-T; GluT-1; glutamate transporter; glutamate/aspartate transporter; Gmt1; High-affinity neuronal glutamate transporter; MGluT1; Slc1a3; Sodium-dependent glutamate/aspartate transporter 1; solute carrier family 1 (glial high affinity glutamate transporter), member 3; solute carrier family 1 member 3; solute carrier family 1, member 3
• Common Name: GLAST
• Gene Symbol: SLC1A3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSETK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining