missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GKN1 (aa 27-95) Control Fragment Recombinant Protein

Product Code. 30201340
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201340

Brand: Invitrogen™ RP95688

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83875 (PA5-83875. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Gastrokine 1, also known as GKN1 and CA11, is a 185 amino acid containing secreted protein belonging to the gastrokine family with a BRICHOS domain and an asn-rich region. GKN1 (also known as an antioncogene) is reported to be down-regulated in human gastric cancer tissue as compared to normal gastric mucosa. Differential display of normal and cancerous gastric tissue suggested that this protein is predominantly expressed in stomach and the expression is down-regulated to considerable frequency in cancer tissue or gastric cancer cell lines examined. This extra cellular protein is co-secreted with mucins and is a signaling growth factor with mitogenic activity and may be involved in maintaining the integrity of the gastric mucosal epithelium.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NS71
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 56287
Name Human GKN1 (aa 27-95) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 18 kDa antrum mucosa protein; 2200002K21Rik; Amp18; AMP-18; Amp18; gastrokine; BRICD1; BRICHOS domain containing 1; Ca11; FOV; foveolin; gastrokine 1; gastrokine-1; Gkn1; Protein CA11; Protein CA11 homolog; UNQ489/PRO1005
Common Name GKN1
Gene Symbol GKN1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.