missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Girdin (aa 1514-1587) Control Fragment Recombinant Protein

Product Code. 30208602
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30208602

Brand: Invitrogen™ RP102807

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58247 (PA5-58247. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Girdin is a Galpha-interacting protein that can enhance the activation of the protein kinase Akt, remodel the actin cytoskeleton, and is thought to be involved in the regulation of cell migration and cancer metastasis. It has recently been shown that Girdin interacts with Disrupted-in-Schizophrenia 1 (DISC1), a susceptibility gene for major psychiatric disorders. DISC1 is thought to be involved in the migration, positioning and differentiation of dentate granule cells (DGCs) during development; depletion of Girdin or blocking the Girdin-DISC1 interaction results in defects in axonal sprouting in the CA3 region of the hippocampus and overextended migration of mispositioning of DGCs, suggesting the Girdin plays a role in postnatal neurogenesis in the dentate gyrus.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q3V6T2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55704
Name Human Girdin (aa 1514-1587) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A430106J12Rik; AI848406; Akt phosphorylation enhancer; AKT-phosphorylation enhancer; Ape; C130096N06Rik; C330012F17Rik; Ccdc88a; coiled coil domain containing 88 A; coiled-coil domain containing 88 A; coiled-coil domain-containing protein 88 A; D130005J21Rik; G alpha-interacting vesicle-associated protein; Galpha-interacting vesicle-associated protein; girders of actin filament; girders of actin filaments; girdin; GIV; Grdn; HkRP1; Hook-related protein 1; KIAA1212; RGD1306694
Common Name Girdin
Gene Symbol CCDC88A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VPDDISTGKRRKELGAMAFSTTAINFSTVNSSAGFRSKQLVNNKDTTSFEDISPQGVSDDSSTGSRVHASRPAS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.