Invitrogen™ Human GIMAP2 (aa 174-255) Control Fragment Recombinant Protein

Product Code. 30198567

Brand: Invitrogen™ RP90717

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (29%), Rat (29%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53067 (PA5-53067. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1.

Specifications

• Accession Number: Q9UG22
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 26157
• Name: Human GIMAP2 (aa 174-255) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: D15S9; GIMAP2; GTPase IMAP family member 2; GTPase, IMAP family member 2; HIMAP2; IAN12; IMAP2; immune-associated nucleotide-binding protein 12; immunity associated protein 2; immunity-associated protein 2; RNF63; ZNF127
• Common Name: GIMAP2
• Gene Symbol: GIMAP2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ACGGRICAFNNRAEGSNQDDQVKELMDCIEDLLMEKNGDHYTNGLYSLIQRSKCGPVGSDERVKEFKQSLIKYMETQRSYTA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining