Invitrogen™ Human GIMA7 (aa 142-219) Control Fragment Recombinant Protein

Product Code. 30199793

Brand: Invitrogen™ RP92810

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (58%), Rat (58%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54171 (PA5-54171. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GIMAP7 is also name as hIAN7 or IAN 7. The function of GIMAP7 remains largely unknown.

Specifications

• Accession Number: Q8NHV1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 168537
• Name: Human GIMA7 (aa 142-219) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: GIMAP7; GTPase IMAP family member 7; GTPase, IMAP family member 7; hIAN7; IAN7; IAN-7; immune associated nucleotide; immune-associated nucleotide-binding protein 7; immunity-associated nucleotide 7 protein
• Common Name: GIMA7
• Gene Symbol: GIMAP7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FHDFIADADVGLKSIVKECGNRCCAFSNSKKTSKAEKESQVQELVELIEKMVQCNEGAYFSDDIYKDTEERLKQREEV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining