Invitrogen™ Human GIGYF1 (aa 947-1022) Control Fragment Recombinant Protein

Product Code. 30196444

Brand: Invitrogen™ RP92754

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54302 (PA5-54302. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May act cooperatively with GRB10 to regulate tyrosine kinase receptor signaling. May increase IGF1 receptor phosphorylation under IGF1 stimulation as well as phosphorylation of IRS1 and SHC1.

Specifications

• Accession Number: O75420
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64599
• Name: Human GIGYF1 (aa 947-1022) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CDS2; GIGYF1; GRB10 interacting GYF protein 1; GRB10-interacting GYF protein 1; GYF domain containing 1; GYF1; PERQ amino acid rich, with GYF domain 1; PERQ amino acid-rich with GYF domain-containing protein 1; PERQ1; postmeiotic segregation increased 2-like 12; PP3360
• Common Name: GIGYF1
• Gene Symbol: GIGYF1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DTLEAKEFAKQFLERRAKQKASQQRQQQQEAWLSSASLQTAFQANHSTKLGPGEGSKAKRRALMLHSDPSILGYSL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining