Invitrogen™ Human GGT7 (aa 369-510) Control Fragment Recombinant Protein

Product Code. 30208961

Brand: Invitrogen™ RP90211

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-53035 (PA5-53035, PA5-64947 (PA5-64947. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GGTL3 is an enzymes involved in both the metabolism of glutathione and in the transpeptidation of amino acids. Changes in the activity of gamma-glutamyltransferase may signal preneoplastic or toxic conditions in the liver or kidney. GGTL3 consists of a heavy and a light chain, and it can interact with CT120, a plasma membrane-associated protein that is possibly involved in lung carcinogenesis.This gene is a member of a gene family that encodes enzymes involved in both the metabolism of glutathione and in the transpeptidation of amino acids. Changes in the activity of gamma-glutamyltransferase may signal preneoplastic or toxic conditions in the liver or kidney. The protein encoded by this gene consists of a heavy and a light chain, and it can interact with CT120, a plasma membrane-associated protein that is possibly involved in lung carcinogenesis.

Specifications

• Accession Number: Q9UJ14
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2686
• Name: Human GGT7 (aa 369-510) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110017C11Rik; 6330563L03Rik; D20S101; dJ18C9.2; gamma-glutamyltransferase 4; gamma-glutamyltransferase 7; gamma-glutamyltransferase 7; glutathione hydrolase 7; gamma-glutamyltransferase-like 3; Gamma-glutamyltransferase-like 5; gamma-glutamyltranspeptidase 7; gamma-glutamyltranspeptidase-like 3; GGT 7; GGT4; Ggt7; GGTL3; GGTL5; Glutathione hydrolase 7; Glutathione hydrolase 7 heavy chain; Glutathione hydrolase 7 light chain; LOC100732094; mFLJ00311 protein
• Common Name: GGT7
• Gene Symbol: Ggt7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HLVLSPPPPHTGPALISALNILEGFNLTSLVSREQALHWVAETLKIALALASRLGDPVYDSTITESMDDMLSKVEAAYLRGHINDSQAAPAPLLPVYELDGAPTAAQVLIMGPDDFIVAMVSSLNQPFGSGLITPSGILLNS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining