missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30213499

Invitrogen™ Human GGPS1 (aa 108-198) Control Fragment Recombinant Protein

Product Code. 30213499
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30213499

Brand: Invitrogen™ RP109722

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144837 (PA5-144837. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of the prenyltransferase family and encodes a protein with geranylgeranyl diphosphate (GGPP) synthase activity. The enzyme catalyzes the synthesis of GGPP from farnesyl diphosphate and isopentenyl diphosphate. GGPP is an important molecule responsible for the C20-prenylation of proteins and for the regulation of a nuclear hormone receptor. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O95749
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9453
Name Human GGPS1 (aa 108-198) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias (2 E,6 E)-farnesyl diphosphate synthase; 1810026C22Rik; 9530089B04Rik; AI843169; C79210; Crlf3; dimethylallyltranstransferase; Farnesyl diphosphate synthase; farnesyltranstransferase; Geranylgeranyl diphosphate synthase; geranylgeranyl diphosphate synthase 1; geranylgeranyl pyrophosphate synthase; geranylgeranyl pyrophosphate synthetase; geranyltranstransferase; GGPP synthase; GGPP synthetase; GGPPS; GGPPS1; GGPPSase; GGPS1; rGGPS1a; rGGPS1a1; rGGPS1a2; rGGPS1a3
Common Name GGPS1
Gene Symbol GGPS1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HPDAVKLFTRQLLELHQGQGLDIYWRDNYTCPTEEEYKAMVLQKTGGLFGLAVGLMQLFSDYKEDLKPLLNTLGLFFQIRDDYANLHSKEY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.