Invitrogen™ Human GGH (aa 122-212) Control Fragment Recombinant Protein

Product Code. 30199987

Brand: Invitrogen™ RP92419

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55230 (PA5-55230. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Gamma-Glutamyl hydrolase (GGH) is a homodimeric protein that catalyzes the cleavage of the gamma-glutamyl chain of folylpoly-gamma-glutamyl substrates and is a central enzyme in folyl and antifolyl poly-gamma-glutamate metabolism. The activities of the baculovirus-expressed enzyme and the enzyme from HL-60 cells were similar on methotrexate polyglutamates. GGH is expressed in a variety of human tumors and correlates with poor prognosis.

Specifications

• Accession Number: Q92820
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8836
• Name: Human GGH (aa 122-212) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: conjugase; FGPH; folylpolyglutamate hydrolase; gamma-GH; gamma-glutamyl hydrolase; gamma-glutamyl hydrolase (conjugase, folylpolygammaglutamyl hydrolase); Gamma-Glu-X carboxypeptidase; GGH; GH
• Common Name: GGH
• Gene Symbol: Ggh
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FDDGDYFPVWGTCLGFEELSLLISGECLLTATDTVDVAMPLNFTGGQLHSRMFQNFPTELLLSLAVEPLTANFHKWSLSVKNFTMNEKLKK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining