Invitrogen™ Human GGCX (aa 535-647) Control Fragment Recombinant Protein

Product Code. 30196574

Brand: Invitrogen™ RP91226

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53770 (PA5-53770. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GGCX (gamma-glutamyl carboxylase), also known as GC or VKCFD1 (Vitamin K-dependent gamma-carboxylase), is a 758 amino acid multi-pass membrane protein. Localized to the membrane of the endoplasmic reticulum, GGCX functions to mediate the vitamin K-dependent carboxylation of glutamate residues on target proteins, thereby producing calcium binding gamma-carboxyglutamate (Gla) residues on these proteins and simultaneously converting vitamin K to vitamin K epoxide. GGCX exists as a monomer and, via its ability to modify glutamate residues, it accomplishes the post-translational changes that are necessary for the activity of all vitamin K-dependent proteins (such as blood coagulation and bone matrix proteins). Defects in the gene encoding GGCX are the cause of combined deficiency of vitamin K-dependent clotting factors 1 (VKCFD1) and PXE-like disorder with multiple coagulation factor deficiency, both of which are characterized by abnormal skin, blood or bone function.

Specifications

• Accession Number: P38435
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2677
• Name: Human GGCX (aa 535-647) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: FLJ26629; Gamma-glutamyl carboxylase; GC; GGCX; Peptidyl-glutamate 4-carboxylase; vitamin K gamma glutamyl carboxylase; Vitamin K-dependent gamma-carboxylase; VKCFD1
• Common Name: GGCX
• Gene Symbol: Ggcx
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FPGLHLENFVSEDLGNTSIQLLQGEVTVELVAEQKNQTLREGEKMQLPAGEYHKVYTTSPSPSCYMYVYVNTTELALEQDLAYLQELKEKVENGSETGPLPPELQPLLEGEVK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining