missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GGCX (aa 535-647) Control Fragment Recombinant Protein

Product Code. 30196574
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196574

Brand: Invitrogen™ RP91226

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53770 (PA5-53770. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GGCX (gamma-glutamyl carboxylase), also known as GC or VKCFD1 (Vitamin K-dependent gamma-carboxylase), is a 758 amino acid multi-pass membrane protein. Localized to the membrane of the endoplasmic reticulum, GGCX functions to mediate the vitamin K-dependent carboxylation of glutamate residues on target proteins, thereby producing calcium binding gamma-carboxyglutamate (Gla) residues on these proteins and simultaneously converting vitamin K to vitamin K epoxide. GGCX exists as a monomer and, via its ability to modify glutamate residues, it accomplishes the post-translational changes that are necessary for the activity of all vitamin K-dependent proteins (such as blood coagulation and bone matrix proteins). Defects in the gene encoding GGCX are the cause of combined deficiency of vitamin K-dependent clotting factors 1 (VKCFD1) and PXE-like disorder with multiple coagulation factor deficiency, both of which are characterized by abnormal skin, blood or bone function.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P38435
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2677
Name Human GGCX (aa 535-647) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias FLJ26629; Gamma-glutamyl carboxylase; GC; GGCX; Peptidyl-glutamate 4-carboxylase; vitamin K gamma glutamyl carboxylase; Vitamin K-dependent gamma-carboxylase; VKCFD1
Common Name GGCX
Gene Symbol Ggcx
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FPGLHLENFVSEDLGNTSIQLLQGEVTVELVAEQKNQTLREGEKMQLPAGEYHKVYTTSPSPSCYMYVYVNTTELALEQDLAYLQELKEKVENGSETGPLPPELQPLLEGEVK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.