Invitrogen™ Human GFM2 (aa 661-741) Control Fragment Recombinant Protein

Product Code. 30193577

Brand: Invitrogen™ RP96919

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57851 (PA5-57851. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GFM2 is involved in mitochondrial translation, which is crucial for maintaining mitochondrial function and mutations in this system lead to a breakdown in the respiratory chain-oxidative phosphorylation system and to impaired maintenance of mitochondrial DNA. In Eukaryotes contain two protein translational systems, one in the cytoplasm and one in the mitochondria. This gene encodes one of mitochondrial translation elongation factors. Its role in the regulation of normal mitochondrial function and in different disease states attributed to mitochondrial dysfunction is not known. Alternative splicing results in at least three transcript variants encoding distinct isoforms.

Specifications

• Accession Number: Q969S9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84340
• Name: Human GFM2 (aa 661-741) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6530419G12Rik; A930009M04Rik; EFG2; EF-G2mt; EF-G2mt {ECO:0000255; Elongation factor G 2, mitochondrial; elongation factor G 2, mitochondrial {ECO:0000255; Elongation factor G2; G elongation factor; G elongation factor mitochondrial 2; G elongation factor, mitochondrial 2; GFM2; HAMAP-Rule:MF_03059}; hEFG2; mEF-G 2; mEF-G 2 {ECO:0000255; mitochondrial elongation factor G2; mitochondrial ribosome recycling factor 2; MRRF2; MST027; MSTP027; RGD1309854; ribosome-releasing factor 2, mitochondrial; ribosome-releasing factor 2, mitochondrial {ECO:0000255; RRF2; RRF2mt; RRF2mt {ECO:0000255
• Common Name: GFM2
• Gene Symbol: Gfm2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TSTTMISACVSRCVQKALKKADKQVLEPLMNLEVTVARDYLSPVLADLAQRRGNIQEIQTRQDNKVVIGFVPLAEIMGYST
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining