Invitrogen™ Human GFM1 (aa 373-453) Control Fragment Recombinant Protein

Product Code. 30204696

Brand: Invitrogen™ RP102635

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57049 (PA5-57049. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Eukaryotes contain two protein translational systems, one in the cytoplasm and one in the mitochondria. Mitochondrial translation is crucial for maintaining mitochondrial function and mutations in this system lead to a breakdown in the respiratory chain-oxidative phosphorylation system and to impaired maintenance of mitochondrial DNA. This gene encodes one of the mitochondrial translation elongation factors. Its role in the regulation of normal mitochondrial function and in different disease states attributed to mitochondrial dysfunction is not known.

Specifications

• Accession Number: Q96RP9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 85476
• Name: Human GFM1 (aa 373-453) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW545374; COXPD1; D3Wsu133e; Efg; EF-G; Efg1; EFGM; EF-Gmt; EF-Gmt {ECO:0000255; EGF1; Elongation factor G 1, mitochondrial; elongation factor G 1, mitochondrial {ECO:0000255; elongation factor G, mitochondrial; elongation factor G, mitochondrial {ECO:0000255; Elongation factor G1; elongation factor G1 {ECO:0000255; G elongation factor 1; G elongation factor mitochondrial 1; G elongation factor, mitochondrial 1; G translation elongation factor, mitochondrial; GFM; Gfm1; HAMAP-Rule:MF_03061}; hEFG1; mEF-G 1; mEF-G 1 {ECO:0000255; mitochondrial; mitochondrial elongation factor G; mitochondrial elongation factor G1
• Common Name: GFM1
• Gene Symbol: GFM1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SYQGELKKGDTIYNTRTRKKVRLQRLARMHADMMEDVEEVYAGDICALFGIDCASGDTFTDKANSGLSMESIHVPDPVISI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining