missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Gemin 3 (aa 352-492) Control Fragment Recombinant Protein

Product Code. 30211326
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211326

Brand: Invitrogen™ RP102050

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52157 (PA5-52157. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Gemin 3 is a member of the DEAD box protein family which are characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD) and are putative RNA helicases. DEAD box proteins such as Gemin 3 are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of DEAD box family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. Gemin 3 has an ATPase activity and a component of the survival of motor neurons (SMN) complex. The Gemin 3 protein may play a catalytic role in the function of the SMN complex on RNPs. Diseases associated with Gemin 3 protein dysfunction include spinal muscular dystrophy and muscular atrophy.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UHI6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 11218
Name Human Gemin 3 (aa 352-492) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias component of gems 3; DDX 20; DD x 20; DEAD (Asp-Glu-Ala-Asp) box polypeptide 20; DEAD box protein 20; DEAD box protein DP 103; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 20; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 20, 103 kD; DEAD/H BOX 20; DEAD-box helicase 20; DEAD-box protein DP103; DKFZP434H052; DP 103; Dp103; GEMIN3; Gemin-3; I79_021005; probable ATP-dependent RNA helicase DD x 20; putative ATP-dependent RNA helicase DD x 20; regulator of steroidogenic factor 1; ROSF-1; SMN-interacting protein
Common Name Gemin 3
Gene Symbol Ddx20
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MAKLKHFHCRVLISTDLTSRGIDAEKVNLVVNLDVPLDWETYMHRIGRAGRFGTLGLTVTYCCRGEEENMMMRIAQKCNINLLPLPDPIPSGLMEECVDWDVEVKAAVHTYGIASVPNQPLKKQIQKIERTLQIQKAHGDH
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.