Invitrogen™ Human Gemin 2 (aa 238-280) Control Fragment Recombinant Protein

Product Code. 30206839

Brand: Invitrogen™ RP105060

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66055 (PA5-66055. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SIP1 is one of the proteins found in the SMN complex, which consists of the survival of motor neuron (SMN) protein and several gemin proteins. The SMN complex is localized to a subnuclear compartment called gems (gemini of coiled bodies) and is required for assembly of spliceosomal snRNPs and for pre-mRNA splicing. SIP1 interacts directly with the SMN and it is required for formation of the SMN complex. A knockout mouse targeting the mouse homolog of this gene exhibited disrupted snRNP assembly and motor neuron degeneration. However, knockdown of the SIP1 mRNA in motor neurons showed normal motor axons while that of SMN mRNA did show abnormal motor axon outgrowth, indicating that SIP1 may have additional roles outside of the SMN complex.

Specifications

• Accession Number: O14893
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8487
• Name: Human Gemin 2 (aa 238-280) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700012N19Rik; Component of gems 2; gem (nuclear organelle) associated protein 2; gem nuclear organelle associated protein 2; gem nuclear organelle associated protein 2 S homeolog; gem-associated protein 2; GEMIN2; Gemin-2; gemin2.S; SIP 1; SIP1; SIP-1; SIP1 delta; sip1-delta; SMN interacting protein 1-delta; SMN interacting protein-1; SMN-interacting protein 1; survival of motor neuron protein interacting protein 1; Survival of motor neuron protein-interacting protein 1; survivor of motor neuron protein interacting protein 1; XELAEV_18042638mg
• Common Name: Gemin 2
• Gene Symbol: GEMIN2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining