Invitrogen™ Human GEM (aa 73-161) Control Fragment Recombinant Protein

Product Code. 30204250

Brand: Invitrogen™ RP93155

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55188 (PA5-55188. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GEM belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction.The protein encoded by this gene belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.

Specifications

• Accession Number: P55040
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2669
• Name: Human GEM (aa 73-161) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AV020497; Gem; GTP binding protein (gene overexpressed in skeletal muscle); GTP binding protein overexpressed in skeletal muscle; GTP-binding mitogen-induced T-cell protein; GTP-binding protein GEM; GTP-binding protein overexpressed in skeletal muscle; kinase-inducible Ras-like protein; KIR; MGC26294; RAS-like protein KIR
• Common Name: GEM
• Gene Symbol: GEM
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NTYYRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERTLMVDGESATIILLDMWENKGENEWLHDHCMQVGDAYLIVYSITD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining