Invitrogen™ Human GDF10 (aa 253-365) Control Fragment Recombinant Protein

Código de producto. 30200746

Marca: Invitrogen™ RP90719

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53311 (PA5-53311. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in mice suggest that the protein encoded by this gene plays a role in skeletal morphogenesis.

Especificaciones

• Accession Number: P55107
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2662
• Name: Human GDF10 (aa 253-365) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BIP; Bmp3b; BMP-3 B; Bone morphogenetic protein 3 B; bone morphogenetic protein 3 B; growth/differentiation factor 10; bone-inducing protein; Gdf10; GDF-10; growth differentiation factor 10; growth/differentiation factor 10; prepro bone inducing protein
• Common Name: GDF10
• Gene Symbol: GDF10
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ISEPNSVAVTLQRYDPFPAGDPEPRAAPNNSADPRVRRAAQATGPLQDNELPGLDERPPRAHAQHFHKHQLWPSPFRALKPRPGRKDRRKKGQEVFMAASQVLDFDEKTMQKA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining