Invitrogen™ Human GCSH (aa 40-102) Control Fragment Recombinant Protein

Product Code. 30182747

Brand: Invitrogen™ RP98558

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59538 (PA5-59538. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The glycine cleavage system catalyzes the degradation of glycine. The H protein (GCSH) shuttles the methylamine group of glycine from the P protein (GLDC) to the T protein (GCST).

Specifications

• Accession Number: P23434
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2653
• Name: Human GCSH (aa 40-102) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1100001L02Rik; 5730591C18Rik; GCE; Gcsh; Glycine cleavage system H protein, mitochondrial; glycine cleavage system protein H; glycine cleavage system protein H (aminomethyl carrier); lipoic acid-containing protein; mitochondrial glycine cleavage system H-protein; NKH
• Common Name: GCSH
• Gene Symbol: GCSH
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining