Invitrogen™ Human GCP3 (aa 338-456) Control Fragment Recombinant Protein

Product Code. 30180949

Brand: Invitrogen™ RP97940

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60549 (PA5-60549. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The gamma-Tubulin complex is composed of gamma Tubulin and the gamma-Tubulin complex associated proteins GCP2, GCP3, GCP4, GCP5 and GCP6, all of which are essential components of microtubule organizing centers. gamma-Tubulin complex components are localized to both the centrosome, where they are involved in microtubule nucleation, and to the cytoplasm, where they exist as soluble complexes that can be recruited to the centrosome as needed. Although the GCP proteins are related, they have distinct roles which contribute to the proper function of the gamma-Tubulin complex. GCP3 (gamma-tubulin complex component 3), also known as TUBGCP3 or SPBC98, localizes to the centrosome and is an ubiquitously expressed 907 amino acid member of the gamma-Tubulin complex.

Specifications

• Accession Number: Q96CW5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10426
• Name: Human GCP3 (aa 338-456) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 104 p; gamma-ring complex protein 104 kDa; Gamma-tubulin complex component 3; GCP3; GCP-3; Grip104; h104p; hGCP3; hGrip104; hSpc98; SPBC98; Spc98; Spc98p; spindle pole body protein; spindle pole body protein Spc98 homolog; Tubgcp3; tubulin gamma complex associated protein 3; tubulin, gamma complex associated protein 3
• Common Name: GCP3
• Gene Symbol: TUBGCP3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLSVLHSQLQLEDDQGVNLGLESSLTLRRLLVWTYDPKIRLKTLAALVDHCQGRKGGELASAVHAYTKTGDPYMRSLVQHILSLVSHPVLSFLYRWIYDGELEDTYHEFFVASDPTVKT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining