Invitrogen™ Human GCNT1 (aa 213-324) Control Fragment Recombinant Protein

Product Code. 30197230

Brand: Invitrogen™ RP102176

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56657 (PA5-56657. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glycosylation is one of the most universal but at the same time complex protein modifications. Modification with sugar moeties can be both co- translational and post- translational, occurring in the endoplasmatic reticulum and golgi. Three different forms of glycosylation can be distinguished: N-linked oligosaccharides, O-linked oligosaccharides and glycosyl- phosphatidylinositol (GPI-) anchors. Glycosylation results in thousands of distinct, bioactive glycoproteins resident throughout the cell that strongly determine protein-protein, carbohydrate-protein, membrane, and adhesion properties. Diseases associated with glycosylation defects include Congenital disorders of glycosylation, (CDG), also known as carbohydrate deficient glycoprotein syndromes, and diseases associated with advanced aging.

Specifications

• Accession Number: Q02742
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2650
• Name: Human GCNT1 (aa 213-324) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5630400D21Rik; B130048E03; beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase; beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N--acetylglucosaminyltransferase; beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase (Core 2 branching enzyme) (Core2-GlcNAc-transferase) (C2GNT); beta1,6 N-acetylglucosaminyltransferase; beta-1,6-N-acetylglucosaminyltransferase; C2 GlcNAcT; C2GNT; C2GNT1; C2GNT-L; core 2 beta1,6 N-acetylglucosaminyltransferase-I; core 2 beta-1,6-N-acetylglucosaminyltransferase I; core 2 branching enzyme; core 2 GlcNAc-T; core 2 GnT; core 2-branching enzyme; Core2-GlcNAc-transferase; enzymatic glycosylation-regulating; G6NT; Gcnt1; glucosaminyl (N-acetyl) transferase 1, core 2; glucosaminyl (N-acetyl) transferase 1, core 2 (beta-1,6-N-acetylglucosaminyltransferase); glucosaminyl transferase 1, core 2; IGnT; NACGT2; NAGCT2
• Common Name: GCNT1
• Gene Symbol: GCNT1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LINLCGMDFPIKTNLEIVRKLKLLMGENNLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLETPLFSGSAYFVVSREYVGYVLQNEKIQKLMEWAQDTYSPDEYLWA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining