Invitrogen™ Human GCN1L1 (aa 621-748) Control Fragment Recombinant Protein

Product Code. 30198710

Brand: Invitrogen™ RP92376

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53848 (PA5-53848. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Acts as a positive activator of the EIF2AK4/GCN2 protein kinase activity in response to amino acid starvation. Forms a complex with EIF2AK4/GCN2 on translating ribosomes; during this process, GCN1 seems to act as a chaperone to facilitate delivery of uncharged tRNAs that enter the A site of ribosomes to the tRNA-binding domain of EIF2AK4/GCN2, and hence stimulating EIF2AK4/GCN2 kinase activity. Participates in the repression of global protein synthesis and in gene-specific mRNA translation activation, such as the transcriptional activator ATF4, by promoting the EIF2AK4/GCN2-mediated phosphorylation of eukaryotic translation initiation factor 2 (eIF-2-alpha/EIF2S1) on 'Ser-52', and hence allowing ATF4-mediated reprogramming of amino acid biosynthetic gene expression to alleviate nutrient depletion. [UniProt]

Specifications

• Accession Number: Q92616
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10985
• Name: Human GCN1L1 (aa 621-748) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4932409G22; AL022764; eIF-2-alpha kinase activator GCN1; G431004K08Rik; Gcn1; GCN1 (general control of amino-acid synthesis 1, yeast)-like 1; GCN1 eIF2 alpha kinase activator homolog; GCN1 eIF-2-alpha kinase activator homolog; GCN1 general control of amino-acid synthesis 1-like 1; GCN1 general control of amino-acid synthesis 1-like 1 (yeast); GCN1, eIF2 alpha kinase activator homolog; GCN1L; GCN1L1; GCN1-like protein 1; General control of amino-acid synthesis 1-like protein 1; hsGCN1; KIAA0219; mKIAA0219; peroxisome proliferator activated receptor interacting complex protein; PRIC295; translational activator GCN1
• Common Name: GCN1L1
• Gene Symbol: GCN1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EALVTDAGEVTEAGKAYVPPRVLQEALCVISGVPGLKGDVTDTEQLAQEMLIISHHPSLVAVQSGLWPALLARMKIDPEAFITRHLDQIIPRMTTQSPLNQSSMNAMGSLSVLSPDRVLPQLISTITA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining