Invitrogen™ Human GCDFP-15 (aa 40-146) Control Fragment Recombinant Protein

Product Code. 30200436

Brand: Invitrogen™ RP89946

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (47%), Rat (47%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82381 (PA5-82381. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Gross cystic disease of the breast is benign premenopausal disorder in which cysts are a predominant pathological lesion. These cysts appear to be formed from excessive apocrine cystic secretions. This fluid is composed of several glycoproteins including a unique 15kDa monomer protein, Gross Cystic Disease Fluid Protein-15 (GCDFP15). Cytosolic analysis of normal tissue specimens from all major organs has demonstrated GCDFP15 in apocrine epithelia, lacrimal, ceruminous and Moll's glands and in numerous serous cells of the submandibular, tracheal, bronchial, sublingual and minor salivary glands. GCDFP15 and prostate specific antigen are co-expressed in androgen receptor-positive breast tumours.

Specifications

• Accession Number: P12273
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5304
• Name: Human GCDFP-15 (aa 40-146) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 14 kDa submandibular gland protein; gcdfp 15; GCDFP15; GCDFP-15; gp17; GPIP4; Gross cystic disease fluid protein 15; HGNC:8993; mSMGP; PIP; prolactin induced protein; prolactin-induced protein; Prolactin-inducible protein; prolactin-inducible protein homolog; SABP; secretory actin-binding protein; SMGP
• Common Name: GCDFP-15
• Gene Symbol: PIP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining