Invitrogen™ Human GCAT (aa 39-109) Control Fragment Recombinant Protein

Product Code. 30212297

Brand: Invitrogen™ RP109052

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140113 (PA5-140113. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The degradation of L-threonine to glycine consists of a two-step biochemical pathway involving the enzymes L-threonine dehydrogenase and 2-amino-3-ketobutyrate coenzyme A ligase. L-Threonine is first converted into 2-amino-3-ketobutyrate by L-threonine dehydrogenase. GCAT is the second enzyme in this pathway, which then catalyzes the reaction between 2-amino-3-ketobutyrate and coenzyme A to form glycine and acetyl-CoA. The enzyme is considered a class II pyridoxal-phosphate-dependent aminotransferase.

Specifications

• Accession Number: O75600
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23464
• Name: Human GCAT (aa 39-109) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2-amino-3-ketobutyrate coenzyme A ligase; 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial; 2-amino-3-ketobutyrate-CoA ligase; AI526977; AKB ligase; aminoacetone synthase; aminoacetone synthetase; aminotransferase; glycine acetyltransferase; aminoacetone synthetase; KBL; GCAT; Glycine acetyltransferase; glycine C-acetyltransferase; glycine C-acetyltransferase (2-amino-3-ketobutyrate coenzyme A ligase); glycine C-acetyltransferase (2-amino-3-ketobutyrate-coenzyme A ligase); KBL; Unknown (protein for MGC:139551)
• Common Name: GCAT
• Gene Symbol: Gcat
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RGAGTWKSERVITSRQGPHIRVDGVSGGILNFCANNYLGLSSHPEVIQAGLQALEEFGAGLSSVRFICGTQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining